Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0610600_circ_g.2 |
ID in PlantcircBase | osa_circ_002580 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 24158656-24160873 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0610600 |
Parent gene annotation |
Endonuclease/exonuclease/phosphatase domain containing protein. (Os01t0610600-01);Similar to endonuclease/exonuclease/phosphatas e family protein. (Os01t0610600-02) |
Parent gene strand | - |
Alternative splicing | Os01g0610600_circ_g.1 Os01g0610600_circ_g.3 Os01g0610600_circ_g.4 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-GC |
Number of exons covered | Os01t0610600-02:1 Os01t0610600-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.105376777 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24160786-24160843(-) |
Potential amino acid sequence |
MDWNWRKEKLVFEFGLWSPDILCLQEVDKFTDLEQEMATRGYNGIWKMRTGNATDGCAIFWRTA RFQLRYQEDIEFNKIDLRDNVAQICVLESVIPGNVQTESSPNHPQQAKQIIVCNTHVLYNPKRG DIKLGQVRTLLDRVYALSKTWNDAPVIICGDFNSTPKRGLRFYHTIY*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |