Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | POPTR_0006s05420_circ_g.4 |
| ID in PlantcircBase | pop_circ_001774 |
| Alias | Chr06:4050777-4051373 |
| Organism | Populus trichocarpa |
| Position | chr6: 3833640-3834236 JBrowse» |
| Reference genome | Populus trichocarpa genome v3.0 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | POPTR_0006s05420 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | POPTR_0006s05420_circ_g.1 POPTR_0006s05420_circ_g.2 POPTR_0006s05420_circ_g.3 POPTR_0006s05420_circ_g.5 |
| Support reads | NA |
| Tissues | stem xylem, stem cambium |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | POPTR_0006s05420.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.564314922 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3834233-3834233(+) 3834233-3834233(+) |
| Potential amino acid sequence |
MTLLLKQKFFTSLAQPGEPVGVLAAQSVGEPSTQMTLLLKQKFFTSLAQPGEPVGVLAAQSVGE PSTQMTLLLKQKFFTSLAQPGEPVGVLAAQSVGEPSTQM(+) MTLLLKQKFFTSLAQPGEPVGVLAAQSVGEPSTQMTLLLKQKFFTSLAQPGEPVGVLAAQSVGE PSTQMTLLLKQKFFTSLAQPGEPVGVLAAQSVGEPSTQM(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zheng et al., 2020; Liu et al., 2021 |