Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0006s05420_circ_g.3 |
ID in PlantcircBase | pop_circ_001773 |
Alias | Chr06:4050777|4051373 |
Organism | Populus trichocarpa |
Position | chr6: 3833640-3834236 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | POPTR_0006s05420 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | POPTR_0006s05420_circ_g.1 POPTR_0006s05420_circ_g.2 POPTR_0006s05420_circ_g.4 POPTR_0006s05420_circ_g.5 |
Support reads | NA |
Tissues | stem cambium |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | POPTR_0006s05420.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.564314922 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3834233-3834233(+) 3834233-3834233(+) |
Potential amino acid sequence |
MTLLLKQKFFTSLAQPGEPVGVLAAQSVGEPSTQMTLLLKQKFFTSLAQPGEPVGVLAAQSVGE PSTQMTLLLKQKFFTSLAQPGEPVGVLAAQSVGEPSTQM(+) MTLLLKQKFFTSLAQPGEPVGVLAAQSVGEPSTQMTLLLKQKFFTSLAQPGEPVGVLAAQSVGE PSTQMTLLLKQKFFTSLAQPGEPVGVLAAQSVGEPSTQM(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zheng et al., 2020 |