Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Gh_A06G1783_circ_g.3 |
| ID in PlantcircBase | ghi_circ_000745 |
| Alias | A06:102794247|102795004 |
| Organism | Gossypium hirsutum |
| Position | chrA06: 102794247-102795004 JBrowse» |
| Reference genome | v1.1 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gh_A06G1783 |
| Parent gene annotation |
SIMILAR TO: AT1G11300, protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding |
| Parent gene strand | + |
| Alternative splicing | Gh_A06G1783_circ_g.1 Gh_A06G1783_circ_g.2 |
| Support reads | 7 |
| Tissues | ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gh_A06G1783:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000793* gra_circ_001175* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
102794397-102794294(+) |
| Potential amino acid sequence |
MNPKISDFGMARIFGVDQTQGTTKRVVGTYGYMSPEYAMHGQFSVKSDVFSFGVLVLEIISGKR NSNFYRTDAADDLISYILRNKHNWIGLHVTRS*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |