Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.010G253400_circ_g.2 |
| ID in PlantcircBase | gra_circ_001175 |
| Alias | Chr10:61915413|61916126 |
| Organism | Gossypium raimondii |
| Position | chrChr10: 61915413-61916126 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.010G253400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | orai.010G253400_circ_g.1 |
| Support reads | 5/17 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.010G253400.1:2 Gorai.010G253400.2:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000793* ghi_circ_000095* |
| PMCS | 0.919638504 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
61915460-61915463(+) |
| Potential amino acid sequence |
MVGVARGMLYLHEDSRLKIIHRDLKVSNILLDSDMNPKISDFGMARIFGVDQTQGTTKRVVGTY GYMSPEYAMHGQFSVKSDVFSFGVLVLEIVSGKRNSSFYRTDAADDLISYILRNKHNWIGLHDT RSW*(+) |
| Sponge-miRNAs | gra-miR8709c |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |