Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0140200_circ_g.3 |
ID in PlantcircBase | osa_circ_006172 |
Alias | NA |
Organism | Oryza sativa |
Position | chr10: 2480269-2480874 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os10g0140200 |
Parent gene annotation |
Glycoside hydrolase, family 38 domain containing protein. (Os10t 0140200-01) |
Parent gene strand | + |
Alternative splicing | Os10g0140200_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os10t0140200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.372419706 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2480839-2480318(+) 2480286-2480289(+) 2480777-2480836(-) |
Potential amino acid sequence |
MARLKNIWFIFSEMVGGVCMMKPPSIILT*(+) MHDEAAVHYIDMIDQTTLGHRVIKKQFNKIPRAGWQIDPFGHSAVQGYLLGAELGFDSMHFARI DYQDRAKRKGDKGLEVIWRGSRTFGSSSQKWWVVYA*(+) MHRIETKLCPKQITLNCRMTKRINLPASSWDLVKLFLDYPMTKCGLINHVNIMDGGFIMHTPPT ISEKMNQMFLSRAI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |