Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0199200_circ_g.8 |
ID in PlantcircBase | osa_circ_042279 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 5037636-5038017 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRI-long |
Parent gene | Os06g0199200 |
Parent gene annotation |
Smr protein/MutS2 C-terminal domain containing protein. (Os06t01 99200-01);Similar to smr domain containing protein. (Os06t019920 0-03);Smr protein/MutS2 C-terminal domain containing protein. (O s06t0199200-04);Smr protein/MutS2 C-terminal domain containing p rotein. (Os06t0199200-05);Similar to smr domain containing prote in. (Os06t0199200-06) |
Parent gene strand | - |
Alternative splicing | Os06g0199200_circ_g.7 Os06g0199200_circ_g.9 Os06g0199200_circ_g.10 Os06g0199200_circ_g.11 Os06g0199200_circ_g.12 Os06g0199200_circ_g.13 Os06g0199200_circ_g.14 Os06g0199200_circ_g.15 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os06t0199200-06:1 Os06t0199200-04:1 Os06t0199200-01:1 Os06t0199200-05:1 Os06t0199200-03:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.393699193 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5037885-5037750(+) 5038019-5038009(-) |
Potential amino acid sequence |
MLRISALPLEKPFWSSTVGSAGKSPVLKFGVLGVRVGLEVASTCIYCISSFEPWSSSCTANTLK LVSRRCFGRRTVLLGYRNS*(+) MQVDATSNPTLTPRTPNFSTGDFPALPTVEDQNGFSKGNADILSIFNGRSSPSVSTGTGDFVSA VRKLASQNSGHWKYKKGPEYGNGVSTVSVPKQYSSTTKTSSGNKFQSVSSARAAPWLETGDAVD AS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | this study |