Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0199200_circ_g.8 |
| ID in PlantcircBase | osa_circ_042279 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 5037636-5038017 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os06g0199200 |
| Parent gene annotation |
Smr protein/MutS2 C-terminal domain containing protein. (Os06t01 99200-01);Similar to smr domain containing protein. (Os06t019920 0-03);Smr protein/MutS2 C-terminal domain containing protein. (O s06t0199200-04);Smr protein/MutS2 C-terminal domain containing p rotein. (Os06t0199200-05);Similar to smr domain containing prote in. (Os06t0199200-06) |
| Parent gene strand | - |
| Alternative splicing | Os06g0199200_circ_g.7 Os06g0199200_circ_g.9 Os06g0199200_circ_g.10 Os06g0199200_circ_g.11 Os06g0199200_circ_g.12 Os06g0199200_circ_g.13 Os06g0199200_circ_g.14 Os06g0199200_circ_g.15 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0199200-06:1 Os06t0199200-04:1 Os06t0199200-01:1 Os06t0199200-05:1 Os06t0199200-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.393699193 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5037885-5037750(+) 5038019-5038009(-) |
| Potential amino acid sequence |
MLRISALPLEKPFWSSTVGSAGKSPVLKFGVLGVRVGLEVASTCIYCISSFEPWSSSCTANTLK LVSRRCFGRRTVLLGYRNS*(+) MQVDATSNPTLTPRTPNFSTGDFPALPTVEDQNGFSKGNADILSIFNGRSSPSVSTGTGDFVSA VRKLASQNSGHWKYKKGPEYGNGVSTVSVPKQYSSTTKTSSGNKFQSVSSARAAPWLETGDAVD AS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |