Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0596400_circ_g.2 |
ID in PlantcircBase | osa_circ_025041 |
Alias | Os04circ12552 |
Organism | Oryza sativa |
Position | chr4: 30082588-30083167 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os04g0596400 |
Parent gene annotation |
Similar to UPF0195 protein CG30152. (Os04t0596400-01) |
Parent gene strand | - |
Alternative splicing | Os04g0596400_circ_g.1 Os04g0596400_circ_g.3 |
Support reads | 2/1 |
Tissues | leaf/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0596400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014726 |
PMCS | 0.398308649 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30083132-30082613(+) 30083157-30082804(+) 30083125-30083143(-) |
Potential amino acid sequence |
MQCTNLYQNGEIPCIEGEDSA*(+) MAKFLVSRGKTPHKFHTQAKSNDGRHTATLHCWGKSNPDMTKFIIDFN*(+) MVVGLINANPVVYEKKERRSRQAPETTDENAAEAIDQLEIFDHIRDIKDPEHPYSLEELNVVTE DSVEINDELSHVRVTFTPTVERCSMATVIGLCLRVKLMRSLPPRYKEFRHSDIN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |