Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Bra030031_circ_g.1 |
| ID in PlantcircBase | bra_circ_000332 |
| Alias | A07:9275090|9275747 |
| Organism | Brassica rapa |
| Position | chrA07: 9275090-9275747 JBrowse» |
| Reference genome | Brassica rapa v2 |
| Type | ie-circRNA |
| Identification method | Find_circ |
| Parent gene | Bra030031 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Bra0A30A0A31:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_002623 ath_circ_002622 |
| PMCS | 0.746713661 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9275696-9275117(+) 9275423-9275122(+) |
| Potential amino acid sequence |
MILRNILLLWTRSSRNMRRSYHQVKLS* MTDAELRDMVSKTLTCRIDKRENCGEKMEEFLKRCFYHTGQYDSQEHFVTLDKKLKEHEAQLSP SQAQLR* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Wang et al., 2019 |