Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d013412_circ_g.1 |
| ID in PlantcircBase | zma_circ_008389 |
| Alias | zma_circ_0001841 |
| Organism | Zea mays |
| Position | chr5: 10601064-10607084 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | u-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d013412 |
| Parent gene annotation |
Histidine kinase 4 |
| Parent gene strand | - |
| Alternative splicing | Zm00001d013412_circ_g.2 |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d013412_T010:10 Zm00001d013412_T005:9 Zm00001d013412_T004:9 Zm00001d013412_T002:10 Zm00001d013412_T006:9 Zm00001d013412_T003:9 Zm00001d013412_T013:10 Zm00001d013412_T012:10 Zm00001d013412_T008:10 Zm00001d013412_T016:10 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.05196542 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10601214-10607035(-) |
| Potential amino acid sequence |
MSSRPPMKSARSAVWMGTSQSPSRRSSSSRRCRSSWTPACPANAEVMRWRTRSRTTPPGRRSSG RC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |