Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d013412_circ_g.1 |
ID in PlantcircBase | zma_circ_008389 |
Alias | zma_circ_0001841 |
Organism | Zea mays |
Position | chr5: 10601064-10607084 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d013412 |
Parent gene annotation |
Histidine kinase 4 |
Parent gene strand | - |
Alternative splicing | Zm00001d013412_circ_g.2 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d013412_T010:10 Zm00001d013412_T005:9 Zm00001d013412_T004:9 Zm00001d013412_T002:10 Zm00001d013412_T006:9 Zm00001d013412_T003:9 Zm00001d013412_T013:10 Zm00001d013412_T012:10 Zm00001d013412_T008:10 Zm00001d013412_T016:10 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.05196542 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
10601214-10607035(-) |
Potential amino acid sequence |
MSSRPPMKSARSAVWMGTSQSPSRRSSSSRRCRSSWTPACPANAEVMRWRTRSRTTPPGRRSSG RC*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |