Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | POPTR_0001s26430_circ_g.1 |
ID in PlantcircBase | pop_circ_000272 |
Alias | Chr01:26669331-26670054 |
Organism | Populus trichocarpa |
Position | chr1: 25467003-25467726 JBrowse» |
Reference genome | Populus trichocarpa genome v3.0 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | POPTR_0001s26430 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | stem xylem |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | POPTR_0001s26430.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | csa_circ_000595 |
PMCS | 0.216151899 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25467126-25467722(-) 25467630-25467711(-) |
Potential amino acid sequence |
MPLIRWTLEKKAALTLRSLGLGCKSSANILLMQIFRSLWKLN*(-) MKMLNPDPKLRLTAQQVLEHPWIQNAKKAPNVPLGETVKARLKQFSVMNKLKKRALRVIAEHLS VEEVAGIKDAFDSMDTGKKGSINLEELRVGLQKLGQHIADADLQILMEAKLSKG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Liu et al., 2021 |