Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Csa1G614120_circ_g.1 |
ID in PlantcircBase | csa_circ_000595 |
Alias | Chr1:24186279_24186925 |
Organism | Cucumis sativus |
Position | chrChr1: 24186279-24186925 JBrowse» |
Reference genome | Cucumis sativus v1.5 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Csa1G614120 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf,root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Csa1G614120.1:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.18518135 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24186384-24186317(+) |
Potential amino acid sequence |
MLDPDPKKRLTAQEVLEHPWLQNAKKAPNVSLGETVKARLKQFSVMNKLKKRALRVIAEHLSVE EVAGIKEAFEMMDTGKRGKINLDELRVGLQKLGQQIPDPDLQILVEAKPNRGWHRLSSDQ* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Zhu et al., 2019 |