Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0846000_circ_g.3 |
ID in PlantcircBase | osa_circ_004810 |
Alias | Os01circ27545 |
Organism | Oryza sativa |
Position | chr1: 36327923-36328628 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os01g0846000 |
Parent gene annotation |
Nucleic acid-binding, OB-fold domain containing protein. (Os01t0 846000-01) |
Parent gene strand | - |
Alternative splicing | Os01g0846000_circ_g.1 Os01g0846000_circ_g.2 |
Support reads | 2/1 |
Tissues | leaf/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0846000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_011447 |
PMCS | 0.206997167 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
36327931-36328533(-) 36328404-36328612(-) |
Potential amino acid sequence |
MEDGLHYAKECDTGITPLASPSAGHALLAVHYSK*(-) MMDAQIPGRHVSQFKPLLKEDAVYYIKYFEVAEARPQYRPIDRMVMAKFTAHTTVREDTEAPST FPSHAYKVLSFDELRGRAYRKDILSDAIGIMTAIGPVQTVSCGGVMKAVLNVHITNGRWITLC* (-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |