Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa6G139140_circ_g.6 |
| ID in PlantcircBase | csa_circ_003770 |
| Alias | Chr6:9776305_9778785 |
| Organism | Cucumis sativus |
| Position | chrChr6: 9776305-9778785 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | CIRI2;Find_circ |
| Parent gene | Csa6G139140 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | Csa6G139140_circ_g.1 Csa6G139140_circ_g.2 Csa6G139140_circ_g.3 Chr6_circ_ig.56 Csa6G139140_circ_g.4 Csa6G139140_circ_g.5 Csa6G139140_circ_g.7 Csa6G139140_circ_g.8 Csa6G139140_circ_g.9 Csa6G139140_circ_g.10 Csa6G139140_circ_g.11 |
| Support reads | NA |
| Tissues | leaf,root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa6G139140.1:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.104822864 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
9777963-9776321(+) 9778743-9776379(+) |
| Potential amino acid sequence |
MPWVQSFKFSNYTCNISAYFITCHVLEEHPCGPEASKWNEHMHYLWKSLFQGDAGRF* MERAYALSMEVALPRGRWKVLIDAAKGCATEPPDLSKYPADFVVISFYKLFGYPTGLGALIVHT DAAKLLKRTYFSGGTVAASIADINYVKRREGIEELFEDGTIPFLSIASLCHGFKVLNSLTIPAI SRHTSSLATYLRNILVALRHPNGTSICTIYGSRSSKGTLEGFDRCCKRMCHRTPRFIQVSC* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhu et al., 2019;He et al., 2020 |