Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d025153_circ_g.1 |
ID in PlantcircBase | zma_circ_010286 |
Alias | Zm10circ00041, zma_circ_0003216, GRMZM2G037335_C1 |
Organism | Zea mays |
Position | chr10: 106782574-106783780 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d025153 |
Parent gene annotation |
Phospholipid-transporting ATPase 2 |
Parent gene strand | - |
Alternative splicing | Zm00001d025153_circ_g.2 Zm00001d025153_circ_g.3 Zm00001d025153_circ_g.4 Zm00001d025153_circ_g.5 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d025153_T007:4 Zm00001d025153_T009:4 Zm00001d025153_T005:4 Zm00001d025153_T001:4 Zm00001d025153_T010:4 Zm00001d025153_T008:4 Zm00001d025153_T003:4 Zm00001d025153_T013:4 Zm00001d025153_T006:4 Zm00001d025153_T011:4 Zm00001d025153_T012:4 Zm00001d025153_T002:4 Zm00001d025153_T004:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.162262859 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
106783747-106783750(-) |
Potential amino acid sequence |
MYSQLGLRTLCLGWRDLKENEYKEWSKNFQKASCSLDNREFKIAEVCNSLEQDLQILGVTAIED RLQDGVPETIKLLRNAGINVWMLTGDKQNTAIQIGLLCNLITSGPNSQLLSISGKTEEDVLRSL ERALFIMKNTSETKDNKYRDILKQ*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |