Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0237700_circ_g.1 |
| ID in PlantcircBase | osa_circ_043402 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 7347505-7348235 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRI-long |
| Parent gene | Os11g0237700 |
| Parent gene annotation |
Similar to URF 4-related. (Os11t0237700-01) |
| Parent gene strand | - |
| Alternative splicing | Os11g0237700_circ_g.2 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0237700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.139101334 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
7347882-7347855(+) 7348217-7348207(-) |
| Potential amino acid sequence |
MSPSIKFIYAVPQVRQGRGVVERTGLLHLRRRRQPPPFKAHTCGLLWHFLLELENLLREVCSAE GPVIHISRHPLHACCSH*(+) MGFERWWLPPPPEVKKPRSLYNAASLAYLGDCIYELYARRHFFFPPLSINDYNKRVMDVVKCES QDLLLNKLLGEDFLTQEESAKEDHKYGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | this study |