Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0237700_circ_g.2 |
ID in PlantcircBase | osa_circ_008917 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 7347809-7348235 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0237700 |
Parent gene annotation |
Similar to URF 4-related. (Os11t0237700-01) |
Parent gene strand | - |
Alternative splicing | Os11g0237700_circ_g.1 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0237700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.534529442 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7347882-7347848(+) 7348217-7348175(-) |
Potential amino acid sequence |
MSPSIKFIYAVPQVRQGRGVVERTGLLHLRRRRQPPPFKAHTCGLLWHCDSHFTTSITRLL*(+ ) MGFERWWLPPPPEVKKPRSLYNAASLAYLGDCIYELYARRHFFFPPLSINDYNKRVMDVVKCES QCQRRPQVWALKGGGCRLRRR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |