Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0321300_circ_g.8 |
ID in PlantcircBase | osa_circ_001545 |
Alias | Os01circ10110 |
Organism | Oryza sativa |
Position | chr1: 12242709-12244645 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, SMALT, Segemehl |
Parent gene | Os01g0321300 |
Parent gene annotation |
Similar to Protein translocase subunit secA. (Os01t0321300-00) |
Parent gene strand | - |
Alternative splicing | Os01g0321300_circ_g.3 Os01g0321300_circ_g.4 Os01g0321300_circ_g.5 Os01g0321300_circ_g.6 Os01g0321300_circ_g.7 Os01g0321300_circ_g.9 Os01g0321300_circ_g.10 Os01g0321300_circ_g.11 Os01g0321300_circ_g.12 Os01g0321300_circ_g.13 Os01g0321300_circ_g.14 Os01g0321300_circ_g.15 Os01g0321300_circ_g.16 Os01g0321300_circ_g.17 Os01g0321300_circ_g.18 |
Support reads | 2/1 |
Tissues | leaf and panicle/shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0321300-00:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002021* |
PMCS | 0.344033411 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12243097-12242874(-) 12242733-12244575(-) |
Potential amino acid sequence |
MTGTAATESQEFESIYKLKVTVVPTNKPMIRKDESDVVFRATNGKWRAAVVEISRMNKVGRPVL VGTTSVEQSETLSEQLHEAGIPHEVDEKQRNVLLTEEGYADAEEILDINDLYDPREQWASYVLN AIKAKELFLRDVNYIVRSKEVLIVDEFTGRVMPGRRWSDGLHQAIEAKEGVPIQNETITLASIS YQNFFLQAISETMWHDWNCCYGKPRVRKHIQTKSYRCSNKQANDTKG*(-) MKQGFLMRLMKSREMFYLQKKAMRTLKKYWT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Chu et al., 2017 |