Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0321300_circ_g.8 |
| ID in PlantcircBase | osa_circ_001545 |
| Alias | Os01circ10110 |
| Organism | Oryza sativa |
| Position | chr1: 12242709-12244645 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os01g0321300 |
| Parent gene annotation |
Similar to Protein translocase subunit secA. (Os01t0321300-00) |
| Parent gene strand | - |
| Alternative splicing | Os01g0321300_circ_g.3 Os01g0321300_circ_g.4 Os01g0321300_circ_g.5 Os01g0321300_circ_g.6 Os01g0321300_circ_g.7 Os01g0321300_circ_g.9 Os01g0321300_circ_g.10 Os01g0321300_circ_g.11 Os01g0321300_circ_g.12 Os01g0321300_circ_g.13 Os01g0321300_circ_g.14 Os01g0321300_circ_g.15 Os01g0321300_circ_g.16 Os01g0321300_circ_g.17 Os01g0321300_circ_g.18 |
| Support reads | 2/1 |
| Tissues | leaf and panicle/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0321300-00:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002021* |
| PMCS | 0.344033411 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12243097-12242874(-) 12242733-12244575(-) |
| Potential amino acid sequence |
MTGTAATESQEFESIYKLKVTVVPTNKPMIRKDESDVVFRATNGKWRAAVVEISRMNKVGRPVL VGTTSVEQSETLSEQLHEAGIPHEVDEKQRNVLLTEEGYADAEEILDINDLYDPREQWASYVLN AIKAKELFLRDVNYIVRSKEVLIVDEFTGRVMPGRRWSDGLHQAIEAKEGVPIQNETITLASIS YQNFFLQAISETMWHDWNCCYGKPRVRKHIQTKSYRCSNKQANDTKG*(-) MKQGFLMRLMKSREMFYLQKKAMRTLKKYWT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |