Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0266900_circ_g.1 |
ID in PlantcircBase | osa_circ_023224 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 11028847-11029738 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0266900 |
Parent gene annotation |
Transketolase C-terminal-like domain containing protein. (Os04t0 266900-01) |
Parent gene strand | + |
Alternative splicing | Os04g0266900_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0266900-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | sly_circ_003072 |
PMCS | 0.35771492 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11028848-11028856(+) |
Potential amino acid sequence |
MDDLKAFRQWGSRTPGHPENFETPGVEVTTGPLGQGFANAVGLALAEKHLAARFNKPDLKIVDH HTYVILGDGCQMEGVSNEASSLAGHWGLGKLIAFYDDNHISIDGSTGIAFTEDALARYEALGWH TIWVKNGNTGYDDIRAAIKEAKAVKDKPTLIKVTTTIGYGSPNKANTYSVHGSALGTKEVEATK NNLSWHHEPFHVPDEVKRWMI*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |