Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0266900_circ_g.2 |
ID in PlantcircBase | osa_circ_023225 |
Alias | Os_ciR3378 |
Organism | Oryza sativa |
Position | chr4: 11029222-11029504 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os04g0266900 |
Parent gene annotation |
Transketolase C-terminal-like domain containing protein. (Os04t0 266900-01) |
Parent gene strand | + |
Alternative splicing | Os04g0266900_circ_g.1 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0266900-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015150 |
PMCS | 0.482737161 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11029251-11029266(+) 11029426-11029266(+) |
Potential amino acid sequence |
MEGVSNEASSLAGHWGLGKLIAFYDDNHISIDGSTGIAFTEDALARYEALGWHTIWVKNGNTGY DDIRAAIKEAKAVKDKPTLIKVCYTWGWLPNGRCVK*(+) MVTQGMMTSVLQLRKQRQSKTSQLLSRYVILGDGCQMEGVSNEASSLAGHWGLGKLIAFYDDNH ISIDGSTGIAFTEDALARYEALGWHTIWVKNGNTGYDDIRAAIKEAKAVKDKPTLIKVCYTWGW LPNGRCVK*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |