Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0266900_circ_g.2 |
| ID in PlantcircBase | osa_circ_023225 |
| Alias | Os_ciR3378 |
| Organism | Oryza sativa |
| Position | chr4: 11029222-11029504 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os04g0266900 |
| Parent gene annotation |
Transketolase C-terminal-like domain containing protein. (Os04t0 266900-01) |
| Parent gene strand | + |
| Alternative splicing | Os04g0266900_circ_g.1 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0266900-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015150 |
| PMCS | 0.482737161 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11029251-11029266(+) 11029426-11029266(+) |
| Potential amino acid sequence |
MEGVSNEASSLAGHWGLGKLIAFYDDNHISIDGSTGIAFTEDALARYEALGWHTIWVKNGNTGY DDIRAAIKEAKAVKDKPTLIKVCYTWGWLPNGRCVK*(+) MVTQGMMTSVLQLRKQRQSKTSQLLSRYVILGDGCQMEGVSNEASSLAGHWGLGKLIAFYDDNH ISIDGSTGIAFTEDALARYEALGWHTIWVKNGNTGYDDIRAAIKEAKAVKDKPTLIKVCYTWGW LPNGRCVK*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |