Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0641800_circ_g.2 |
ID in PlantcircBase | osa_circ_015754 |
Alias | Os_ciR7940 |
Organism | Oryza sativa |
Position | chr2: 25768223-25769566 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os02g0641800 |
Parent gene annotation |
Similar to RNA helicase (Fragment). (Os02t0641800-01);Similar to ATP-dependent RNA helicase dhh1. (Os02t0641800-02) |
Parent gene strand | + |
Alternative splicing | Os02g0641800_circ_g.3 Os02g0641800_circ_g.4 Os02g0641800_circ_g.5 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0641800-01:2 Os02t0641800-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.290722191 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25769393-25768245(+) |
Potential amino acid sequence |
MGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEKIDQEKNAIQVHKTGR PN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |