Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0470600_circ_g.9 |
ID in PlantcircBase | osa_circ_014660 |
Alias | Os_ciR7709 |
Organism | Oryza sativa |
Position | chr2: 15972648-15972751 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os02g0470600 |
Parent gene annotation |
Similar to phosphoinositide binding. (Os02t0470600-00) |
Parent gene strand | - |
Alternative splicing | Os02g0470600_circ_g.6 Os02g0470600_circ_g.7 Os02g0470600_circ_g.8 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0470600-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.404610577 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
15972659-15972736(+) |
Potential amino acid sequence |
MVPTNPAFTVTGSRREFSASAFNFRSLRTTSPLKLWCQQTQLSLLLEAEENSVHQPSILGL*(+ ) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |