Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G10350_circ_g.3 |
| ID in PlantcircBase | ath_circ_020821 |
| Alias | At_ciR4353, Ath_circ_FC1895 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 3209868-3210384 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT3G10350 |
| Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT3G10350_circ_g.1 AT3G10350_circ_g.2 |
| Support reads | 3 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G10350.1:3 AT3G10350.2:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.173692233 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3210047-3210381(+) |
| Potential amino acid sequence |
MVKVRELFRDTESTEFVIVTIPTVMAVSESSRLSASLKKESVPVKRLIVNQLLPPSSSDCKFCS IKRKLRQKITSATSAIKSVFGKEEKGPDAADKLEKLRERMVKVRELFRDTESTEFVIVTIPTVM AVSESSRLSASLKKESVPVKRLIVNQLLPPSSSDCKFCSIKRKLRQKITSATSAIKSVFGKEEK GPDAADKLEKLRERMVKVRELFRDTESTEFVIVTIPTVMAVSESSRLSASLKKESVPVKRLIVN QLLPPSSSDCKFCSIKRKLRQKITSATSAIKSVFGKEEKGPDAADKLEKLRERMVKVRELFRDT ESTEFVIVTIPTVMAVSESSRLSASLKKESVPVKRLIVNQLLPPSSSDCKFCSIKRK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chen et al., 2017a |