Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G10350_circ_g.2 |
ID in PlantcircBase | ath_circ_020820 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 3209689-3210115 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, CIRI-full |
Parent gene | AT3G10350 |
Parent gene annotation |
P-loop containing nucleoside triphosphate hydrolases superfamily protein |
Parent gene strand | + |
Alternative splicing | AT3G10350_circ_g.1 AT3G10350_circ_g.3 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G10350.1:3 AT3G10350.2:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.182356441 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3210047-3210112(+) |
Potential amino acid sequence |
MVKVRELFRDTESTEFVIVTIPTGHTLRLLSLPDFLDASIGKILKLRQKITSATSAIKSVFGKE EKGPDAADKLEKLRERMVKVRELFRDTESTEFVIVTIPTGHTLRLLSLPDFLDASIGKILKLRQ KITSATSAIKSVFGKEEKGPDAADKLEKLRERMVKVRELFRDTESTEFVIVTIPTGHTLRLLSL PDFLDASIGKILKLRQKITSATSAIKSVFGKEEKGPDAADKLEKLRERMVKVRELFRDTESTEF VIVTIPT(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |