Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0311300_circ_g.11 |
ID in PlantcircBase | osa_circ_019498 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 11112997-11118809 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0311300 |
Parent gene annotation |
Similar to HAD-superfamily hydrolase, subfamily IA, variant 3 co ntaining protein, expressed. (Os03t0311300-01);Similar to HAD-su perfamily hydrolase, subfamily IA, variant 3 containing protein, expressed. (Os03t0311300-02);NHL repeat domain containing prote in. (Os03t0311300-03) |
Parent gene strand | + |
Alternative splicing | Os03g0311300_circ_g.4 Os03g0311300_circ_g.5 Os03g0311300_circ_g.6 Os03g0311300_circ_g.7 Os03g0311300_circ_g.8 Os03g0311300_circ_g.9 Os03g0311300_circ_g.10 Os03g0311300_circ_g.12 Os03g0311300_circ_g.13 Os03g0311300_circ_g.14 Os03g0311300_circ_g.15 Os03g0311300_circ_g.16 Os03g0311300_circ_g.17 Os03g0311300_circ_g.18 Os03g0311300_circ_g.19 Os03g0311300_circ_g.20 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0311300-02:6 Os03t0311300-03:6 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.306809055 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11113016-11113000(+) |
Potential amino acid sequence |
MYLWRELGVNSWPTFVVIGPNGKVLAQISGEGHRKDLDDVVGAALEFYEENKLLQNSSLPLALE KDKDSRLLASPLKFPGKLAIDVLNNRLFISDSNHNRIVVTNLEGEFICQIGSSEEGLLDGTFDT ASFNRPQGLAYNSKKNILYVADTENHALREINFVSETVKTLAGNGTKGSDYRGGGQGTNQVLNS PWDVCYDPSKETLYIAMAGQHQIWKHNTLDGVTEVLSGDGYERNLNGSRL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |