Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G24706_circ_g.9 |
| ID in PlantcircBase | ath_circ_004204 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 8747607-8748044 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT1G24706 |
| Parent gene annotation |
THO complex subunit 2 |
| Parent gene strand | + |
| Alternative splicing | AT1G24706_circ_g.1 AT1G24706_circ_g.2 AT1G24706_circ_g.3 AT1G24706_circ_g.4 AT1G24706_circ_g.5 AT1G24706_circ_g.6 AT1G24706_circ_g.7 AT1G24706_circ_g.8 |
| Support reads | 2 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G24706.4:3 AT1G24706.5:3 AT1G24706.6:3 AT1G24706.3:3 AT1G24706.7:3 AT1G24706.2:3 AT1G24706.1:3 AT1G24706.8:3 AT1G24706.9:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.182177017 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8747837-8748041(+) |
| Potential amino acid sequence |
MVAKLAHANPMTVLRTIVNQIEAYRDMIAPVVDAFKYLTQARYRLYGEWEKDDEQNPLLLAARQ VAKLDTRRILKRLAKENLKQLGRMVAKLAHANPMTVLRTIVNQIEAYRDMIAPVVDAFKYLTQA RYRLYGEWEKDDEQNPLLLAARQVAKLDTRRILKRLAKENLKQLGRMVAKLAHANPMTVLRTIV NQIEAYRDMIAPVVDAFKYLTQARYRLYGEWEKDDEQNPLLLAARQVAKLDTRRILKRLAKENL KQLGRMVAKLAHANPMTVLRTIVNQIEAYRDMIAPVVDAFKYLTQ(+) |
| Sponge-miRNAs | ath-miR5632-5p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |