Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0673000_circ_g.1 |
| ID in PlantcircBase | osa_circ_025912 |
| Alias | Os_ciR3044 |
| Organism | Oryza sativa |
| Position | chr4: 34347369-34348357 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os04g0673000 |
| Parent gene annotation |
Similar to H0322F07.7 protein. (Os04t0673000-01);Homeodomain-lik e containing protein. (Os04t0673000-02);Similar to H0322F07.7 pr otein. (Os04t0673000-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0673000_circ_g.2 Os04g0673000_circ_g.3 Os04g0673000_circ_g.4 Os04g0673000_circ_g.5 Os04g0673000_circ_g.6 Os04g0673000_circ_g.7 |
| Support reads | 4/2 |
| Tissues | root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0673000-01:3 Os04t0673000-02:3 Os04t0673000-03:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.111828151 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34348306-34347381(+) 34347466-34347770(-) |
| Potential amino acid sequence |
MIVFFQEMLCCTIHDRNFILSS*(+) MSETPGIMGQMPQLPVQVNEDHLSSLLQLDRMKFLSWIVQHSISWKKTIIYSTKSPQISKHSRR ERTRISFFGQTTTSKIF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |