Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0673000_circ_g.2 |
| ID in PlantcircBase | osa_circ_025913 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 34347369-34350648 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0673000 |
| Parent gene annotation |
Similar to H0322F07.7 protein. (Os04t0673000-01);Homeodomain-lik e containing protein. (Os04t0673000-02);Similar to H0322F07.7 pr otein. (Os04t0673000-03) |
| Parent gene strand | - |
| Alternative splicing | Os04g0673000_circ_g.1 Os04g0673000_circ_g.3 Os04g0673000_circ_g.4 Os04g0673000_circ_g.5 Os04g0673000_circ_g.6 Os04g0673000_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0673000-01:6 Os04t0673000-02:6 Os04t0673000-03:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.119362973 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34350628-34349688(-) |
| Potential amino acid sequence |
MKYIKIAAMLPNRTVRDVALRCWWATSKDRRKKPDGFYTGKKIRDMKPIQDKMVASASMANFHL APANTVTPFSISMQHTNQQCQVPKEVPVVDSATQHLLEENNHLLNQIATNIETFKTGENTDLFF RTNNNFKNILSRMSETPGIMGQMPQLPVQVNEDHLSSLLQLDRMICSRTEYHEVHKNSSYATQQ DCQGCCIAVLVGYK*(-) |
| Sponge-miRNAs | osa-miR5528 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |