Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os10g0513200_circ_g.1 |
ID in PlantcircBase | osa_circ_007661 |
Alias | Os10circ07636 |
Organism | Oryza sativa |
Position | chr10: 19779401-19779888 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, circseq_cup, find_circ |
Parent gene | Os10g0513200 |
Parent gene annotation |
Boric acid channel, Regulation of boron distribution (Os10t05132 00-01) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3/9/18 |
Tissues | panicle/root/shoot, root, pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os10t0513200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002906* osi_circ_008606 |
PMCS | 0.349305618 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19779408-19779407(+) |
Potential amino acid sequence |
MRMLRVTAAPTAMPASSPTARVSVATAVTTKRRLKVMMNSVKKAWAVEMVGSGTVTPPERKGWK TPLRAKPAQMEPSTWTATYAGTCSHGKWRSAAKAMVSDGLRWAPEMCPVDRMMVVTASPAHAAF PNGEIAPPYFWFTIGAAVAKKMRMNVPTNSAPSRR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Lu et al., 2015;Ye et al., 2016;Chu et al., 2017 |