Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0513200_circ_g.1 |
| ID in PlantcircBase | osa_circ_007661 |
| Alias | Os10circ07636 |
| Organism | Oryza sativa |
| Position | chr10: 19779401-19779888 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, CIRI, KNIFE, PcircRNA_finder, SMALT, Segemehl, circRNA_finder, circseq_cup, find_circ |
| Parent gene | Os10g0513200 |
| Parent gene annotation |
Boric acid channel, Regulation of boron distribution (Os10t05132 00-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3/9/18 |
| Tissues | panicle/root/shoot, root, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0513200-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002906* osi_circ_008606 |
| PMCS | 0.349305618 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19779408-19779407(+) |
| Potential amino acid sequence |
MRMLRVTAAPTAMPASSPTARVSVATAVTTKRRLKVMMNSVKKAWAVEMVGSGTVTPPERKGWK TPLRAKPAQMEPSTWTATYAGTCSHGKWRSAAKAMVSDGLRWAPEMCPVDRMMVVTASPAHAAF PNGEIAPPYFWFTIGAAVAKKMRMNVPTNSAPSRR*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Ye et al., 2016;Chu et al., 2017 |