Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0218500_circ_g.4 |
| ID in PlantcircBase | osa_circ_030213 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 6091994-6092331 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0218500 |
| Parent gene annotation |
MCM family protein. (Os06t0218500-01);MCM family protein. (Os06t 0218500-02);Non-protein coding transcript. (Os06t0218500-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0218500_circ_g.5 Os06g0218500_circ_g.6 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0218500-02:2 Os06t0218500-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.230066864 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6092010-6092016(+) 6092008-6092297(-) 6092060-6092297(-) |
| Potential amino acid sequence |
MQHNPPSARTRAPASSIHSPPSLTAVTVKPALVLPRPVVITERLLNLAANFRNWDLPVPIKFIY AA*(+) MNLIGTGKSQFLKFAAKLSNRSVITTGLGSTSAGLTVTAVKDGGEWMLEAGALVLADGGLCCID EFDRHWQIPVSEICC*(-) MLEAGALVLADGGLCCIDEFDRHWQIPVSEICC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |