Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0710800_circ_g.3 |
| ID in PlantcircBase | osa_circ_021207 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 28665413-28666040 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0710800 |
| Parent gene annotation |
14-3-3-like protein S94. (Os03t0710800-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0710800_circ_g.1 Os03g0710800_circ_g.2 Os03g0710800_circ_g.4 Os03g0710800_circ_g.5 Os03g0710800_circ_g.6 Os03g0710800_circ_g.7 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os03t0710800-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013494 |
| PMCS | 0.577792197 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
28665463-28665439(+) 28665482-28665862(-) |
| Potential amino acid sequence |
MSPAEASREENVYMAKLAEQAERYEEMVEFMEKVAKTTDVGELTVEERNLLSVAYKNVIGARRA SWRIISSIEQKEESRGNEAYVASIKEYRSRIETELSKICDGILKLLDSHLVPSATAAESKVFYL KMKGDYHRYLAEFKSGAERKEAAENTLVAYKSAQVHKVRLSLR*(+) MPQQATFFLSFVLQRKLSLTLCTWADLYATRVFSAASFLSAPDLNSARYLW*(-) |
| Sponge-miRNAs | osa-miR167i-5p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |