Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G78660_circ_g.2 |
| ID in PlantcircBase | ath_circ_010803 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 29586431-29586683 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT1G78660 |
| Parent gene annotation |
Gamma-glutamyl hydrolase 1 |
| Parent gene strand | + |
| Alternative splicing | AT1G78660_circ_g.1 AT1G78660_circ_g.3 AT1G78660_circ_g.4 AT1G78660_circ_g.5 1_circ_ag.6 AT1G78660_circ_g.7 1_circ_ag.8 1_circ_ag.9 1_circ_ag.10 AT1G78670_circ_g.1 AT1G78670_circ_g.2 AT1G78670_circ_g.3 AT1G78670_circ_g.4 AT1G78670_circ_g.5 1_circ_ag.6 AT1G78670_circ_g.7 1_circ_ag.8 AT1G78670_circ_g.9 1_circ_ag.10 AT1G78670_circ_g.11 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G78660.3:2 AT1G78660.2:2 AT1G78660.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.204386231 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29586663-29586680(+) |
| Potential amino acid sequence |
MSIIISQKLELVNGVIFTGGWAKKYDYFEIVKKIFTKALERNDAGEHFPVYGICLGFELMSIII SQKLELVNGVIFTGGWAKKYDYFEIVKKIFTKALERNDAGEHFPVYGICLGFELMSIIISQKLE LVNGVIFTGGWAKKYDYFEIVKKIFTKALERNDAGEHFPVYGICLGFELMSIIISQ(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |