Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0554300_circ_g.1 | 
| ID in PlantcircBase | osa_circ_015003 | 
| Alias | NA | 
| Organism | Oryza sativa | 
| Position | chr2: 20922960-20923725 JBrowse» | 
| Reference genome | IRGSP-1.0.38 | 
| Type | e-circRNA | 
| Identification method | CIRCexplorer | 
| Parent gene | Os02g0554300 | 
| Parent gene annotation | 
							Similar to SAC1-like protein AtSAC1b (SAC domain protein 6). (Os 02t0554300-01)  | 
					
| Parent gene strand | - | 
| Alternative splicing | Os02g0554300_circ_g.2 | 
| Support reads | 1 | 
| Tissues | shoot | 
| Exon boundary | Yes-Yes | 
| Splicing signals | CT-AC | 
| Number of exons covered | Os02t0554300-01:3 | 
					
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_008721 | 
| PMCS | 0.136662043 | 
| Functional Information | |
|---|---|
| Coding potential | Y | 
| Potential coding position | 
							20923345-20923696(-) | 
					
| Potential amino acid sequence | 
							MDLLQGHYIISVSRDMAGPSKAGLLENYASFRLAFALVMGALMFMMMSLRQGMGREVPREF*(- )  | 
					
| Sponge-miRNAs | NA | 
| circRNA-miRNA-mRNA network | VISUALIZATION | 
| Potential function description | NA | 
| Other Information | |
|---|---|
| References | Chu et al., 2017 |