Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA027201_circ_g.13 |
ID in PlantcircBase | osi_circ_007665 |
Alias | 8:14879373|14883625 |
Organism | Oryza sativa ssp. indica |
Position | chr8: 14879373-14883625 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA027201 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA027201_circ_g.1 BGIOSGA027201_circ_g.2 BGIOSGA027201_circ_g.3 BGIOSGA027201_circ_g.4 BGIOSGA027201_circ_g.5 BGIOSGA027201_circ_g.6 BGIOSGA027201_circ_g.7 BGIOSGA027201_circ_g.8 BGIOSGA027201_circ_g.9 BGIOSGA027201_circ_g.10 BGIOSGA027201_circ_g.11 BGIOSGA027201_circ_g.12 BGIOSGA027201_circ_g.14 BGIOSGA027201_circ_g.15 BGIOSGA027201_circ_g.16 BGIOSGA027201_circ_g.17 BGIOSGA027201_circ_g.18 BGIOSGA027201_circ_g.19 BGIOSGA027201_circ_g.20 BGIOSGA027201_circ_g.21 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA027201-TA:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_036685* |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14881108-14881105(-) |
Potential amino acid sequence |
MNKIGLMLPQKYWQLGNDGLLAFVNNFLKEHFLPAIFVDYRKCVQQAISRMDQKAFLLLFALRM QQSLRQTKVKDGEETQQYHKKAMEQQVSYLTKGFSLQHQFTVLYLSL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |