Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA027201_circ_g.13 |
| ID in PlantcircBase | osi_circ_007665 |
| Alias | 8:14879373|14883625 |
| Organism | Oryza sativa ssp. indica |
| Position | chr8: 14879373-14883625 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA027201 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | BGIOSGA027201_circ_g.1 BGIOSGA027201_circ_g.2 BGIOSGA027201_circ_g.3 BGIOSGA027201_circ_g.4 BGIOSGA027201_circ_g.5 BGIOSGA027201_circ_g.6 BGIOSGA027201_circ_g.7 BGIOSGA027201_circ_g.8 BGIOSGA027201_circ_g.9 BGIOSGA027201_circ_g.10 BGIOSGA027201_circ_g.11 BGIOSGA027201_circ_g.12 BGIOSGA027201_circ_g.14 BGIOSGA027201_circ_g.15 BGIOSGA027201_circ_g.16 BGIOSGA027201_circ_g.17 BGIOSGA027201_circ_g.18 BGIOSGA027201_circ_g.19 BGIOSGA027201_circ_g.20 BGIOSGA027201_circ_g.21 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | BGIOSGA027201-TA:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osa_circ_036685* |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
14881108-14881105(-) |
| Potential amino acid sequence |
MNKIGLMLPQKYWQLGNDGLLAFVNNFLKEHFLPAIFVDYRKCVQQAISRMDQKAFLLLFALRM QQSLRQTKVKDGEETQQYHKKAMEQQVSYLTKGFSLQHQFTVLYLSL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |