Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0298400_circ_g.3 |
| ID in PlantcircBase | osa_circ_030595 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 11087240-11087928 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os06g0298400 |
| Parent gene annotation |
WW/Rsp5/WWP domain containing protein. (Os06t0298400-01) |
| Parent gene strand | + |
| Alternative splicing | Os06g0298400_circ_g.1 Os06g0298400_circ_g.2 Os06g0298400_circ_g.4 Os06g0298400_circ_g.5 Os06g0298400_circ_g.6 Os06g0298400_circ_g.7 Os06g0298400_circ_g.8 Os06g0298400_circ_g.9 |
| Support reads | 1 |
| Tissues | root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os06t0298400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | zma_circ_002928 |
| PMCS | 0.269571892 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11087853-11087279(+) 11087282-11087882(-) 11087313-11087829(-) |
| Potential amino acid sequence |
MMKRKRKQQINPMMKQRLILQMQVIRGNTFERGRARGKP*(+) MVFPSLSLFRRCSPLSPASAGLASVSSLG*(-) MVKWEPQFVGHGFPLALPLSKVFPLITCICRISLCFIIGLICCFLFLFIITILPKQR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |