Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os06g0298400_circ_g.3 |
ID in PlantcircBase | osa_circ_030595 |
Alias | NA |
Organism | Oryza sativa |
Position | chr6: 11087240-11087928 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os06g0298400 |
Parent gene annotation |
WW/Rsp5/WWP domain containing protein. (Os06t0298400-01) |
Parent gene strand | + |
Alternative splicing | Os06g0298400_circ_g.1 Os06g0298400_circ_g.2 Os06g0298400_circ_g.4 Os06g0298400_circ_g.5 Os06g0298400_circ_g.6 Os06g0298400_circ_g.7 Os06g0298400_circ_g.8 Os06g0298400_circ_g.9 |
Support reads | 1 |
Tissues | root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os06t0298400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_002928 |
PMCS | 0.269571892 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11087853-11087279(+) 11087282-11087882(-) 11087313-11087829(-) |
Potential amino acid sequence |
MMKRKRKQQINPMMKQRLILQMQVIRGNTFERGRARGKP*(+) MVFPSLSLFRRCSPLSPASAGLASVSSLG*(-) MVKWEPQFVGHGFPLALPLSKVFPLITCICRISLCFIIGLICCFLFLFIITILPKQR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |