Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0596600_circ_g.9 |
| ID in PlantcircBase | osa_circ_029255 |
| Alias | Os_ciR3080 |
| Organism | Oryza sativa |
| Position | chr5: 29735603-29736170 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | Os05g0596600 |
| Parent gene annotation |
Similar to SMC5 protein. (Os05t0596600-01);Similar to SMC5 prote in. (Os05t0596600-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0596600_circ_g.3 Os05g0596600_circ_g.4 Os05g0596600_circ_g.5 Os05g0596600_circ_g.6 Os05g0596600_circ_g.7 Os05g0596600_circ_g.8 |
| Support reads | 4/2 |
| Tissues | root/shoot, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0596600-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.426571785 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29736045-29735872(+) 29736116-29735796(+) 29736013-29736156(-) |
| Potential amino acid sequence |
MLTNDRHILTWTTDSGYLGSKSQKCLALVHHLLYCVFHLYLYTTRLRVSSCLFFSNIIVSVISS FFLRIFAASSSNCLCSFRSFFKSSSMPSISLICLSF*(+) MPSFGTSSALLCVSSVPIYNTSPCFFLPLLLKHHRVCNLFLFPANFCCFIF*(+) MCNLDVIDSERLRSQKDKHIKDIDGMDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKR QEETRRRVVYRYR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |