Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0596600_circ_g.8 |
ID in PlantcircBase | osa_circ_029254 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 29735603-29735909 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os05g0596600 |
Parent gene annotation |
Similar to SMC5 protein. (Os05t0596600-01);Similar to SMC5 prote in. (Os05t0596600-02) |
Parent gene strand | - |
Alternative splicing | Os05g0596600_circ_g.3 Os05g0596600_circ_g.4 Os05g0596600_circ_g.5 Os05g0596600_circ_g.6 Os05g0596600_circ_g.7 Os05g0596600_circ_g.9 |
Support reads | 2 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0596600-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006447* |
PMCS | 0.130292888 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29735843-29735605(-) |
Potential amino acid sequence |
MDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKRQEETRRRVDLDVIDSERLRSQKDKH IKDIDGMDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKRQEETRRRVDLDVIDSERLR SQKDKHIKDIDGMDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKRQEETRRRVDLDVI DSERLRSQKDKHIKDIDGMDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKRQEETRRR V(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |