Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0596600_circ_g.8 |
| ID in PlantcircBase | osa_circ_029254 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 29735603-29735909 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os05g0596600 |
| Parent gene annotation |
Similar to SMC5 protein. (Os05t0596600-01);Similar to SMC5 prote in. (Os05t0596600-02) |
| Parent gene strand | - |
| Alternative splicing | Os05g0596600_circ_g.3 Os05g0596600_circ_g.4 Os05g0596600_circ_g.5 Os05g0596600_circ_g.6 Os05g0596600_circ_g.7 Os05g0596600_circ_g.9 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0596600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006447* |
| PMCS | 0.130292888 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29735843-29735605(-) |
| Potential amino acid sequence |
MDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKRQEETRRRVDLDVIDSERLRSQKDKH IKDIDGMDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKRQEETRRRVDLDVIDSERLR SQKDKHIKDIDGMDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKRQEETRRRVDLDVI DSERLRSQKDKHIKDIDGMDEDLKKLLKEQRQLEDEAAKIRRKKEEITDTMMFEKKRQEETRRR V(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |