Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0267600_circ_g.3 |
ID in PlantcircBase | osa_circ_038672 |
Alias | NA |
Organism | Oryza sativa |
Position | chr9: 5103873-5104501 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os09g0267600 |
Parent gene annotation |
Similar to Charged multivesicular body protein 4b. (Os09t0267600 -01);Similar to Charged multivesicular body protein 4b. (Os09t02 67600-02) |
Parent gene strand | + |
Alternative splicing | Os09g0267600_circ_g.2 Os09g0267600_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0267600-01:3 Os09t0267600-02:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.156626471 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5103903-5103971(+) 5104177-5104421(-) |
Potential amino acid sequence |
MFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNKRAAIQS LKRKKLYEQQIEQLGNFQLRIHDQSLDLILQAQPCSTGSLVSPRSRPMLVRWPRLIS*(+) MSRVSFNLSSVANALALACSLGLPKSLLNMAAPVILNPNSDHEFSTGSSLAAQFVVHKAFFSSR IG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |