Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0267600_circ_g.3 |
| ID in PlantcircBase | osa_circ_038672 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr9: 5103873-5104501 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os09g0267600 |
| Parent gene annotation |
Similar to Charged multivesicular body protein 4b. (Os09t0267600 -01);Similar to Charged multivesicular body protein 4b. (Os09t02 67600-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0267600_circ_g.2 Os09g0267600_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0267600-01:3 Os09t0267600-02:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.156626471 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5103903-5103971(+) 5104177-5104421(-) |
| Potential amino acid sequence |
MFNRLFGKPKEQANASALATLDKLNETLDMLEKKEKVLEKKAAAELERAKEFSKAKNKRAAIQS LKRKKLYEQQIEQLGNFQLRIHDQSLDLILQAQPCSTGSLVSPRSRPMLVRWPRLIS*(+) MSRVSFNLSSVANALALACSLGLPKSLLNMAAPVILNPNSDHEFSTGSSLAAQFVVHKAFFSSR IG*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |