Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os09g0267600_circ_g.4 |
ID in PlantcircBase | osa_circ_038673 |
Alias | Os_ciR11993 |
Organism | Oryza sativa |
Position | chr9: 5103873-5105175 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
Parent gene | Os09g0267600 |
Parent gene annotation |
Similar to Charged multivesicular body protein 4b. (Os09t0267600 -01);Similar to Charged multivesicular body protein 4b. (Os09t02 67600-02) |
Parent gene strand | + |
Alternative splicing | Os09g0267600_circ_g.2 Os09g0267600_circ_g.3 |
Support reads | 2/5 |
Tissues | root/shoot, root, seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os09t0267600-02:5 Os09t0267600-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018844 |
PMCS | 0.408322237 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5105135-5103971(+) 5104177-5105032(-) |
Potential amino acid sequence |
MSLQPCKLKWHCDQSLDLILQAQPCSTGSLVSPRSRPMLVRWPRLIS*(+) MSRVSFNLSSVANALALACSLGLPKSLLNMAAPVILNPNSDHNAISACKAASSSSSADAFCGAG RVGILVPGTCTGCTGGAATGSRS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |