Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os09g0267600_circ_g.4 |
| ID in PlantcircBase | osa_circ_038673 |
| Alias | Os_ciR11993 |
| Organism | Oryza sativa |
| Position | chr9: 5103873-5105175 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder, find_circ |
| Parent gene | Os09g0267600 |
| Parent gene annotation |
Similar to Charged multivesicular body protein 4b. (Os09t0267600 -01);Similar to Charged multivesicular body protein 4b. (Os09t02 67600-02) |
| Parent gene strand | + |
| Alternative splicing | Os09g0267600_circ_g.2 Os09g0267600_circ_g.3 |
| Support reads | 2/5 |
| Tissues | root/shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os09t0267600-02:5 Os09t0267600-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_018844 |
| PMCS | 0.408322237 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5105135-5103971(+) 5104177-5105032(-) |
| Potential amino acid sequence |
MSLQPCKLKWHCDQSLDLILQAQPCSTGSLVSPRSRPMLVRWPRLIS*(+) MSRVSFNLSSVANALALACSLGLPKSLLNMAAPVILNPNSDHNAISACKAASSSSSADAFCGAG RVGILVPGTCTGCTGGAATGSRS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |