Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0212200_circ_g.12 |
ID in PlantcircBase | osa_circ_023099 |
Alias | Os_ciR9726 |
Organism | Oryza sativa |
Position | chr4: 7514309-7515211 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os04g0212200 |
Parent gene annotation |
Similar to protein binding protein. (Os04t0212200-01) |
Parent gene strand | + |
Alternative splicing | Os04g0212200_circ_g.3 Os04g0212200_circ_g.4 Os04g0212200_circ_g.5 Os04g0212200_circ_g.6 Os04g0212200_circ_g.7 Os04g0212200_circ_g.8 Os04g0212200_circ_g.9 Os04g0212200_circ_g.10 Os04g0212200_circ_g.11 Os04g0212200_circ_g.13 |
Support reads | 2/1 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os04t0212200-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015084 |
PMCS | 0.167117128 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
7514550-7514318(+) |
Potential amino acid sequence |
MSELDRVTQDYKIHRDEIHTKLVQIMRERLLANLRKLPQIVESWNGPEDTDLQPSQFAKSVTKE VSYLHRILSQTLLEADVQLIFRCLV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |