Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0740300_circ_g.2 |
ID in PlantcircBase | osa_circ_016481 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 30962975-30964081 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0740300 |
Parent gene annotation |
ATPase, AAA-type, core domain containing protein. (Os02t0740300- 01) |
Parent gene strand | - |
Alternative splicing | Os02g0740300_circ_g.1 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0740300-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.357737767 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30963975-30964020(-) 30963064-30964073(-) |
Potential amino acid sequence |
MLLRAWNSVAARQITLNPHKKTTSNGDDNEDDLCVLIFEPLVGSQYSVSSYEVEFIKRGGFSLR ELEALTSVLKLVGQKDVKQSSGKGNKSYTTRKGNGQRSKHVPSMEKTISDLEGMGVRVYGFDET SSIPMDGSGTVMWENIAGYEPQKRWSLNLMYHQLVAYQTLLLIS*(-) MDLMRPQVFQWMVVVLLCGRTLLDMNLRKGGR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |