Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0740300_circ_g.2 |
| ID in PlantcircBase | osa_circ_016481 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 30962975-30964081 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0740300 |
| Parent gene annotation |
ATPase, AAA-type, core domain containing protein. (Os02t0740300- 01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0740300_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0740300-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.357737767 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30963975-30964020(-) 30963064-30964073(-) |
| Potential amino acid sequence |
MLLRAWNSVAARQITLNPHKKTTSNGDDNEDDLCVLIFEPLVGSQYSVSSYEVEFIKRGGFSLR ELEALTSVLKLVGQKDVKQSSGKGNKSYTTRKGNGQRSKHVPSMEKTISDLEGMGVRVYGFDET SSIPMDGSGTVMWENIAGYEPQKRWSLNLMYHQLVAYQTLLLIS*(-) MDLMRPQVFQWMVVVLLCGRTLLDMNLRKGGR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |