Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os08g0512400_circ_g.1 |
ID in PlantcircBase | osa_circ_037656 |
Alias | Os_ciR4123 |
Organism | Oryza sativa |
Position | chr8: 25405871-25407203 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os08g0512400 |
Parent gene annotation |
Protein of unknown function DUF296 domain containing protein. (O s08t0512400-01);Similar to AT-hook protein 1. (Os08t0512400-02) |
Parent gene strand | - |
Alternative splicing | Os08g0512400_circ_g.2 Os08g0512400_circ_g.3 |
Support reads | 2/5 |
Tissues | root/shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os08t0512400-02:3 Os08t0512400-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_018070 |
PMCS | 0.232710559 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25406376-25407161(-) |
Potential amino acid sequence |
MSFAQHGNRAVCVLSANGAISNVTLRQTATSGGTVTYEGRFEILSLSGSFLLTDHGGQRSRTGG LSVSLAGPDGRLLGGGVAGLLIAATPVQDRRELDLHHTLLQF*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |