Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0512400_circ_g.2 |
| ID in PlantcircBase | osa_circ_037657 |
| Alias | Os_ciR11553 |
| Organism | Oryza sativa |
| Position | chr8: 25405871-25408300 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0512400 |
| Parent gene annotation |
Protein of unknown function DUF296 domain containing protein. (O s08t0512400-01);Similar to AT-hook protein 1. (Os08t0512400-02) |
| Parent gene strand | - |
| Alternative splicing | Os08g0512400_circ_g.1 Os08g0512400_circ_g.3 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0512400-02:4 Os08t0512400-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.22741452 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25407719-25405881(+) 25407898-25407880(-) |
| Potential amino acid sequence |
MRGLLVEPLGRPRFFTPSGHPDDKKLAGGFGCVGENGPGTPCATGVDAAAVGEVTNPSDMDPSG PYFLGRPRLFLVSPKTLTQSRGNSYPPMRAHEHVRRLGLGIWEPGLE*(+) MSLGLVTSPTAAASTPVAQGVPGPFSPTQPKPPASFLSSGWPDGVKKRGRPKGSTNKPRIDAVG SAGVGFTPHVITVLAGEDVSAKIMSFAQHGNRAVCVLSANGAISNVTLRQTATSGGTVTYEGRF EILSLSGSFLLTDHGGQRSRTGGLSVSLAGPDGRLLGGGVAGLLIAATPVQVPKSLALISSRAR ELSSVDTNFRGFVLEFLVIQETSAGGRGSTAPTGPCRWGW*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |