Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0189600_circ_g.4 |
| ID in PlantcircBase | osa_circ_008746 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 4545956-4546069 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0189600 |
| Parent gene annotation |
Similar to Cycloartenol synthase. (Os11t0189600-01);Similar to c DNA clone:J013062J12, full insert sequence. (Os11t0189600-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0189600_circ_g.5 Os11g0189600_circ_g.6 Os11g0189600_circ_g.7 Os11g0189600_circ_g.8 Os11g0189600_circ_g.9 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0189600-01:1 Os11t0189600-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.313590058 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4546059-4546066(+) 4546006-4546007(-) |
| Potential amino acid sequence |
MKMQALNILACWIEDPSSEAFKCHIARVYDYLWIAEDGMKMQALNILACWIEDPSSEAFKCHIA RVYDYLWIAEDGMKMQALNILACWIEDPSSEAFKCHIARVYDYLWIAEDGMKMQ(+) MPLSLDLQSSKQGYLMPASSCRLQRSINNHIRVQYGI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |