Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Solyc01g100650.2_circ_g.3 |
| ID in PlantcircBase | sly_circ_000397 |
| Alias | 1:82389755|82392213 |
| Organism | Solanum lycopersicum |
| Position | chr1: 90628955-90631413 JBrowse» |
| Reference genome | SL2.50.38 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Solyc01g100650.2 |
| Parent gene annotation |
protein_coding |
| Parent gene strand | + |
| Alternative splicing | Solyc01g100650.2_circ_g.1 Solyc01g100650.2_circ_g.2 Solyc01g100650.2_circ_g.4 Solyc01g100650.2_circ_g.5 Solyc01g100650.2_circ_g.6 Solyc01g100650.2_circ_g.7 Solyc01g100650.2_circ_g.8 Solyc01g100650.2_circ_g.9 |
| Support reads | 6 |
| Tissues | fruit |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Solyc01g100650.2.1:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.160844232 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
90631317-90628955(+) 90629047-90631411(-) |
| Potential amino acid sequence |
MAGQHQIWEHKTLDGVTRAFSGNGYERNLNGSR*(+) MLHHQSYRHEDPLLLCFQLGLKSSLLDQLLP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | fruit ripening |
| Other Information | |
|---|---|
| References | Yin et al., 2018 |