Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0127700_circ_g.2 |
ID in PlantcircBase | osa_circ_012924 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 1438385-1440559 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0127700 |
Parent gene annotation |
Similar to Ribose-phosphate pyrophosphokinase. (Os02t0127700-01) ;Ribose-phosphate pyrophosphokinase 1 (EC 2.7.6.1) (Phosphoribos yl pyrophosphate synthetase 1). (Os02t0127700-02) |
Parent gene strand | - |
Alternative splicing | Os02g0127700_circ_g.1 Os02g0127700_circ_g.3 Os02g0127700_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0127700-02:6 Os02t0127700-01:7 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.165632962 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
1439871-1440537(-) |
Potential amino acid sequence |
MELLIMIDACRRASAKNITAVIPYFGYARADRKSQGRESIAAKLVANMITEAGANRVLVCDLHS SQAMGYFDIPVDHVYGQPVILDYLASKTICSDDLVVVSPDVGGVARARAFAKKLSDAPLAIVDK RRHGHNVAEVMNLIGDVRGKVAVMMDDMIDTAGTIAKGAELLHQEGAREVYACCTHAVFRGARR LIN*(-) |
Sponge-miRNAs | osa-miR2105 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |