Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0127700_circ_g.1 |
| ID in PlantcircBase | osa_circ_012923 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 1438385-1439407 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0127700 |
| Parent gene annotation |
Similar to Ribose-phosphate pyrophosphokinase. (Os02t0127700-01) ;Ribose-phosphate pyrophosphokinase 1 (EC 2.7.6.1) (Phosphoribos yl pyrophosphate synthetase 1). (Os02t0127700-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0127700_circ_g.2 Os02g0127700_circ_g.3 Os02g0127700_circ_g.4 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0127700-02:4 Os02t0127700-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.216182234 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1439277-1438411(+) 1439367-1439388(-) |
| Potential amino acid sequence |
MIYWDVKVSHGLTGMKITYKDTVRTSFCNHISYKFCSYRFTALRLKTACVQHA*(+) MITEAGANRVLVCDLHSSQAMGYFDIPVDHVYGQPVILDYLASKTICSDDLVVVSPDVGGVARA RAFAKKLSDAPLAIVDKRRHGHNVAEVMNLIGDVRGKVAVMMDDMIDTAGTIAKGAELLHQEGA REVYACCTHAVFSLKAVNL*(-) |
| Sponge-miRNAs | osa-miR2105 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |