Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0507200_circ_g.4 |
ID in PlantcircBase | osa_circ_033963 |
Alias | NA |
Organism | Oryza sativa |
Position | chr7: 19254017-19255305 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os07g0507200 |
Parent gene annotation |
Cell cycle regulated microtubule associated protein domain conta ining protein. (Os07t0507200-01) |
Parent gene strand | - |
Alternative splicing | Os07g0507200_circ_g.1 Os07g0507200_circ_g.2 Os07g0507200_circ_g.3 Os07g0507200_circ_g.5 Os07g0507200_circ_g.6 Os07g0507200_circ_g.7 Os07g0507200_circ_g.8 Os07g0507200_circ_g.9 Os07g0507200_circ_g.10 Os07g0507200_circ_g.11 Os07g0507200_circ_g.12 Os07g0507200_circ_g.13 Os07g0507200_circ_g.14 Os07g0507200_circ_g.15 Os07g0507200_circ_g.16 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0507200-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.246762723 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19255268-19254133(+) 19254110-19255223(-) |
Potential amino acid sequence |
MSCSSLHRFKMKLSFIMGCAFTTLLWASSLSILSLSSIILCCSISCLTKLSN*(+) MEQQRIMEERERMEREEAQRRVVKAHPIMKESFILKRWRELHDMQTPVPKLLPWGLSG*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |