Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G04750_circ_g.2 |
| ID in PlantcircBase | ath_circ_029701 |
| Alias | AT4G04750_C1, AT4G04750_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 2419612-2420019 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | AT4G04750 |
| Parent gene annotation |
Major facilitator superfamily protein |
| Parent gene strand | + |
| Alternative splicing | AT4G04750_circ_g.1 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G04750.2:3 AT4G04750.3:3 AT4G04750.1:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.13419036 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2419673-2420016(+) |
| Potential amino acid sequence |
MQLFVGVGLSAFYALGTAVAWRSLAILGSIPSLVVLPLLFFIPESPRWLGPIYISELAPRNLRG AASSLMQLFVGVGLSAFYALGTAVAWRSLAILGSIPSLVVLPLLFFIPESPRWLGPIYISELAP RNLRGAASSLMQLFVGVGLSAFYALGTAVAWRSLAILGSIPSLVVLPLLFFIPESPRWLGPIYI SELAPRNLRGAASSLMQLFVGVGLSAFYALGTAVAWRSLAILGSIPSLVVLPLLFFIPESPRWL |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Zhang et al., 2019 |