Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0337600_circ_g.10 |
| ID in PlantcircBase | osa_circ_001625 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 13257123-13257688 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0337600 |
| Parent gene annotation |
Similar to predicted protein. (Os01t0337600-01);Similar to bindi ng. (Os01t0337600-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0337600_circ_g.5 Os01g0337600_circ_g.6 Os01g0337600_circ_g.7 Os01g0337600_circ_g.8 Os01g0337600_circ_g.9 Os01g0337600_circ_g.11 Os01g0337600_circ_g.12 Os01g0337600_circ_g.13 Os01g0337600_circ_g.14 Os01g0337600_circ_g.15 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0337600-02:2 Os01t0337600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009352 |
| PMCS | 0.140030315 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13257164-13257160(+) 13257154-13257658(-) |
| Potential amino acid sequence |
MPPSNIVFKIKGRLDNSTGGSSLSSPLTERKDSYLVLSTLPRASDL*(+) MRVAELITQDMNPSAPLMVS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |